PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000269415
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 425aa    MW: 47453.1 Da    PI: 9.6689
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000269415genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox261.6e-08147190245
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVk 45 
                    rk+ +++k+q + Lee F+++++++ +++  LAk+l+L  rqV 
  MDP0000269415 147 RKKLRLSKSQSTFLEESFKEHNTLNPKQKLALAKQLNLRPRQVE 190
                    778899************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-9134190IPR009057Homeodomain-like
SuperFamilySSF466897.7E-8139189IPR009057Homeodomain-like
CDDcd000863.00E-6147189No hitNo description
PfamPF000464.6E-6147190IPR001356Homeobox domain
Gene3DG3DSA:2.130.10.101.6E-36213367IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509781.71E-36217369IPR017986WD40-repeat-containing domain
SMARTSM003205.3E-4237276IPR001680WD40 repeat
PROSITE profilePS5029426.894244371IPR017986WD40-repeat-containing domain
PROSITE profilePS500829.272244285IPR001680WD40 repeat
PfamPF004000.18244274IPR001680WD40 repeat
SMARTSM003209.7E-11279318IPR001680WD40 repeat
PfamPF004002.2E-6281318IPR001680WD40 repeat
PROSITE profilePS5008212.38286320IPR001680WD40 repeat
SMARTSM003201.9E-6321362IPR001680WD40 repeat
PfamPF004002.6E-4324362IPR001680WD40 repeat
PROSITE profilePS5008213.382328364IPR001680WD40 repeat
PROSITE patternPS006780349363IPR019775WD40 repeat, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MGGNMDIGFC MGMVTAAFGV VRSDESNRKS TYEVYDQEER RRIPRSHVSS QLRFPWLTNN  60
LAVSEPAGSS DGPGIGLDVN RMLGVLASAE EAEDAAAQLS SPNNTVSSFQ MDFGMRNGGR  120
LSKRDXDVDX DKVSSRASDD EENGSARKKL RLSKSQSTFL EESFKEHNTL NPKQKLALAK  180
QLNLRPRQVE SLPLKKNYRC VPSLQQFYSG SPFAVSSDGS FITCKCDESR KIVDSSNASI  240
RSTIEGDSNK VTALAFSPNN RLFFSTSHSR QIKIGDLFTL KCVRSWKGHE GPVMGMSCHP  300
SGRLFATAGD DMKVLVWDVD GIFCTHYFKG HKGVVFSVLF HPDPTKQLLF SASNDTNVHV  360
WDLKFFALNH TDLDLLQTKE RRVTDRSNQD LQRTLPTESK RKAEKPRKIT WLTLQKQGIK  420
GSLKT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_K5e-13221363178318Pre-mRNA-splicing factor prp5
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.264470.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008347593.10.0PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor TFIID subunit 5-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-13homeobox from Arabidopsis thaliana